The domain within your query sequence starts at position 111 and ends at position 161; the E-value for the DEAD_2 domain shown below is 3.3e-16.
YASRTHSQLTQVIRELRNTAYRPKVCVLGSREQLCIHPEVKKQESNHMQIS
DEAD_2 |
---|
PFAM accession number: | PF06733 |
---|---|
Interpro abstract (IPR010614): | This represents a conserved region within a number of RAD3-like DNA-binding helicases that are seemingly ubiquitous - members include proteins of eukaryotic, bacterial and archaeal origin. RAD3 is involved in nucleotide excision repair, and forms part of the transcription factor TFIIH in yeast [ (PUBMED:10915862) ]. |
GO function: | DNA binding (GO:0003677), DNA helicase activity (GO:0003678), ATP binding (GO:0005524) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry DEAD_2