SMART: Pfam domain DEPP

The domain within your query sequence starts at position 25 and ends at position 70; the E-value for the DEPP domain shown below is 3e-22.

GAAGQEPPASPSLDDYVRCICQLAQPTSVLDKVTAQSRPNRPSRPA

DEPP

PFAM accession number:	PF15343
Interpro abstract (IPR020133):	This entry represents proteins from various mammals known as DEPP proteins, which are decidual proteins induced by progesterone. Decidualization of the endometrial stromal cells (ESC) is thought to be stimulated by progesterone and/or cAMP and is crucial for embryo implantation and placentation. Increased expression of Depp was observed in endometria during mid- and late-secretory phases and 1st trimester deciduas. Depp increased the level of phosphorylated Erk and activated the Elk-1 transcription factor in human embryonal kidney 293 cells, suggesting that Depp modulates the effects of progesterone during decidualization and in the decidua by affecting gene expression [ (PUBMED:16123073) ].

PFAM accession number:

PF15343

Interpro abstract (IPR020133):

This entry represents proteins from various mammals known as DEPP proteins, which are decidual proteins induced by progesterone.

Decidualization of the endometrial stromal cells (ESC) is thought to be stimulated by progesterone and/or cAMP and is crucial for embryo implantation and placentation. Increased expression of Depp was observed in endometria during mid- and late-secretory phases and 1st trimester deciduas. Depp increased the level of phosphorylated Erk and activated the Elk-1 transcription factor in human embryonal kidney 293 cells, suggesting that Depp modulates the effects of progesterone during decidualization and in the decidua by affecting gene expression [ (PUBMED:16123073) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry DEPP