The domain within your query sequence starts at position 273 and ends at position 429; the E-value for the DHC_N1 domain shown below is 6.6e-37.
DKELVQRLETSMIHWTRQIKEVLSAQESVETGENLGPLEEIEFWHNRCMDLSSISKQLVK KGVKHIESILFLAKSSYLTPFRKLAQQIQDGSRQAQSNLTFLSILREPYQELAFMKPKDI SEKLPKLISLIRIIWVNSPHYNTRERLTALFRKVCEC
DHC_N1 |
---|
PFAM accession number: | PF08385 |
---|---|
Interpro abstract (IPR013594): | Dynein heavy chains interact with other heavy chains to form dimers, and with intermediate chain-light chain complexes to form a basal cargo binding unit [ (PUBMED:10862709) ]. The region featured in this family includes the sequences implicated in mediating these interactions [ (PUBMED:10336435) ]. It is thought to be flexible and not to adopt a rigid conformation [ (PUBMED:10862709) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry DHC_N1