The domain within your query sequence starts at position 19 and ends at position 181; the E-value for the DHH domain shown below is 2.5e-10.
HVVLGNEACDLDSMVSALALAFYLTKTSEAEDIFIPVLNIKRSELPLRGDNVFFLQEVKI PEPALIFRDEIDLLALHQAGQLTLILVDHHILPKSDAALEEAVAEVLDHRPIEQKYCPPC HVSVELVGSCATLVTERILQGAPETLDRQTAALLHGTIILDCV
DHH |
---|
PFAM accession number: | PF01368 |
---|---|
Interpro abstract (IPR001667): | This is a domain of predicted phosphoesterases, including Drosophila prune protein and bacterial RecJ exonuclease [ (PUBMED:9478130) ]. The RecJ protein of Escherichia coli plays an important role in a number of DNA repair and recombination pathways. RecJ catalyzes processive degradation of single-stranded DNA in a 5'-to-3' direction. Sequences highly related to those encoding RecJ can be found in many of the eubacterial genomes sequenced to date [ (PUBMED:10633092) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry DHH