The domain within your query sequence starts at position 4 and ends at position 171; the E-value for the DJ-1_PfpI domain shown below is 1.2e-55.
KRALVILAKGAEEMETVIPVDVMRRAGIKVTVAGLAGKDPVQCSRDVMICPDTSLEDAKT QGPYDVVVLPGGNLGAQNLSESPMVKEILKEQESRKGLIAAICAGPTALLAHEVGFGCKV TTHPLAKDKMMNGSHYSYSESRVEKDGLILTSRGPGTSFEFALAIVEA
DJ-1_PfpI |
---|
PFAM accession number: | PF01965 |
---|---|
Interpro abstract (IPR002818): | The domain is found in intracellular cysteine peptidase PfpI [ (PUBMED:8626329) ] and other members of the DJ-1/ThiJ/PfpI superfamily [ (PUBMED:14745011) ]. Some of these have been characterised:
It is also found in transcriptional regulators in combination with a HTH(araC) domain, such as in Pseudomonas aeruginosa cdhR [ (PUBMED:19406895) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry DJ-1_PfpI