The domain within your query sequence starts at position 878 and ends at position 939; the E-value for the DMPK_coil domain shown below is 1.2e-29.
ELQSALEAEIRAKQLVQEELRKVKDSSLAFESKLKESEAKNRELLEEMQSLRKRMEEKFR AD
DMPK_coil |
![]() |
---|
PFAM accession number: | PF08826 |
---|---|
Interpro abstract (IPR014930): | This domain is found in the myotonic dystrophy protein kinase (DMPK) and adopts a coiled coil structure. It plays a role in dimerisation [ (PUBMED:12832055) ]. |
GO process: | protein phosphorylation (GO:0006468) |
GO function: | protein serine/threonine kinase activity (GO:0004674), ATP binding (GO:0005524) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry DMPK_coil