The domain within your query sequence starts at position 878 and ends at position 939; the E-value for the DMPK_coil domain shown below is 1.2e-29.

ELQSALEAEIRAKQLVQEELRKVKDSSLAFESKLKESEAKNRELLEEMQSLRKRMEEKFR
AD

DMPK_coil

DMPK_coil
PFAM accession number:PF08826
Interpro abstract (IPR014930):

This domain is found in the myotonic dystrophy protein kinase (DMPK) and adopts a coiled coil structure. It plays a role in dimerisation [ (PUBMED:12832055) ].

GO process:protein phosphorylation (GO:0006468)
GO function:protein serine/threonine kinase activity (GO:0004674), ATP binding (GO:0005524)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry DMPK_coil