SMART: Pfam domain DMRT-like

The domain within your query sequence starts at position 242 and ends at position 369; the E-value for the DMRT-like domain shown below is 3.1e-54.

LSGEPQGPPNLPHTCSTLILQSCGTPDSLLLQPQAPGASCLAWTSGPSERQLQREAAEAL
VGLKDSSQAPRLTPSVPPNPAWISLLHPCGPPAPPGGRGFQPVGPPLRPSPGSSVSLHIG
RLGSISLL

DMRT-like

PFAM accession number:	PF15791
Interpro abstract (IPR031577):	The vertebrate DMRT (doublesex-and mab-3-related transcription factor) gene family encodes putative transcription factors related to the sexual regulators Doublesex (Drosophila melanogaster) and MAB-3 (Caenorhabditis elegans). They share a highly conserved DNA binding motif, the DM domain. This entry represents a domain found in the C-terminal of the DMRT C1 and C2 proteins. DMRTC1 (also known as DMRT8) is located on the X chromosome in placental mammals. It is related to DMRTC2 (DMRT7) but has lost the DM domain [ (PUBMED:16488114) ].

PFAM accession number:

PF15791

Interpro abstract (IPR031577):

The vertebrate DMRT (doublesex-and mab-3-related transcription factor) gene family encodes putative transcription factors related to the sexual regulators Doublesex (Drosophila melanogaster) and MAB-3 (Caenorhabditis elegans). They share a highly conserved DNA binding motif, the DM domain. This entry represents a domain found in the C-terminal of the DMRT C1 and C2 proteins. DMRTC1 (also known as DMRT8) is located on the X chromosome in placental mammals. It is related to DMRTC2 (DMRT7) but has lost the DM domain [ (PUBMED:16488114) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry DMRT-like