The domain within your query sequence starts at position 16 and ends at position 104; the E-value for the DNA_methylase domain shown below is 8.2e-10.
IRVLSLFDGIATGLLVLKDLGIQVDRYIASEVCEDSITVGMVRHQGKIMYVGDVRSVTQK HIQEWGPFDLVIGGSPCNDLSIVNPARKG
DNA_methylase |
![]() |
---|
PFAM accession number: | PF00145 |
---|---|
Interpro abstract (IPR001525): | C-5 cytosine-specific DNA methylases ( EC 2.1.1.37 ) (C5 Mtase) are enzymes that specifically methylate the C-5 carbon of cytosines in DNA to produce C5-methylcytosine [ (PUBMED:3248729) (PUBMED:8127644) (PUBMED:2716049) ]. In mammalian cells, cytosine-specific methyltransferases methylate certain CpG sequences, which are believed to modulate gene expression and cell differentiation. In bacteria, these enzymes are a component of restriction-modification systems and serve as valuable tools for the manipulation of DNA [ (PUBMED:7773746) (PUBMED:8127644) ]. The structure of HhaI methyltransferase (M.HhaI) has been resolved to 2.5 A [ (PUBMED:8343957) ]: the molecule folds into 2 domains - a larger catalytic domain containing catalytic and cofactor binding sites, and a smaller DNA recognition domain. This entry also includes tRNA (cytosine(38)-C(5))-methyltransferase ( EC 2.1.1.204 ), also known as DNMT2 (DNA (cytosine-5)-methyltransferase-like protein 2), that specifically methylates cytosine 38 in the anticodon loop of tRNA (Asp) [ (PUBMED:16424344) ]. |
GO function: | methyltransferase activity (GO:0008168) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry DNA_methylase