The domain within your query sequence starts at position 41 and ends at position 102; the E-value for the DNA_pol_alpha_N domain shown below is 5.5e-22.
LERLKKAKAGEKYKYEVEDLTSVYEEVDEEQYSKLVQARQDDDWIVDDDGIGYVEDGREI FD
DNA_pol_alpha_N |
 |
|---|
| PFAM accession number: | PF12254 |
|---|---|
| Interpro abstract (IPR024647): | This entry represents the N-terminal domain of DNA polymerase alpha catalytic subunit (the DNA polymerase alpha complex is composed of four subunits). This domain is approximately 70 amino acids in length and it contains a specific labile site [ (PUBMED:2243771) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry DNA_pol_alpha_N