The domain within your query sequence starts at position 286 and ends at position 421; the E-value for the DNMT1-RFD domain shown below is 3.4e-40.
YEDSPMHRFTSFSVYCSRGHLCPVDTGLIEKNVELYFSGCAKAIHDENPSMEGGINGKNL GPINQWWLSGFDGGEKVLIGFSTAFAEYILMEPSKEYEPIFGLMQEKIYISKIVVEFLQN NPDAVYEDLINKIETT
DNMT1-RFD |
---|
PFAM accession number: | PF12047 |
---|---|
Interpro abstract (IPR022702): | This domain is part of a cytosine specific DNA methyltransferase enzyme (DNMT). It functions non-catalytically to target the protein towards replication foci. This allows the DNMT1 protein to methylate the correct residues. This domain targets DMAP1 and HDAC2 to the replication foci during the S phase of mitosis. They are thought to have some importance in conversion of critical histone lysine moieties [ (PUBMED:10888872) ]. A structure exists for the human cytosine specific DNA methyltransferase replication foci domain [ (PUBMED:21389349) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry DNMT1-RFD