The domain within your query sequence starts at position 115 and ends at position 182; the E-value for the DNase_II domain shown below is 4.3e-15.
HTKGKQLTYTYPLVYDHKLEGFFAQKLPDLETVIKNQHVLHEPWNSSVILTSQAGATFQS FAKFGKF
DNase_II |
---|
PFAM accession number: | PF03265 |
---|---|
Interpro abstract (IPR004947): | Deoxyribonuclease II ( EC 3.1.22.1 ) hydrolyses DNA under acidic conditions with a preference for double-stranded DNA. It catalyses the endonucleolytic cleavage of DNA to 3'-phosphomononucleotide and 3'-phosphooligonucleotide end-products. The enzyme may play a role in apoptosis. This family also includes hypothetical proteins from Caenorhabditis elegans. |
GO process: | DNA metabolic process (GO:0006259) |
GO function: | deoxyribonuclease II activity (GO:0004531) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry DNase_II