The domain within your query sequence starts at position 5 and ends at position 80; the E-value for the DPM2 domain shown below is 4.2e-35.
TDQAVGFGLVAVSLIIFTYYTTWVILLPFIDSQHVIHKYFLPRAYAVLLPLAAGLLLLLF VGLFITYVMLKSQKIT
DPM2 |
![]() |
---|
PFAM accession number: | PF07297 |
---|---|
Interpro abstract (IPR009914): | This family consists of several eukaryotic dolichol phosphate-mannose biosynthesis regulatory (DPM2) proteins. Biosynthesis of glycosylphosphatidylinositol and N-glycan precursor is dependent upon a mannosyl donor, dolichol phosphate-mannose (DPM). DPM2, an 84 amino acid membrane protein expressed in the endoplasmic reticulum (ER), makes a complex with DPM1 that is essential for the ER localisation and stable expression of DPM1. Moreover, DPM2 enhances binding of dolichol phosphate, a substrate of DPM synthase. Biosynthesis of DPM in mammalian cells is regulated by DPM2 [ (PUBMED:9724629) ]. |
GO process: | dolichol metabolic process (GO:0019348) |
GO component: | integral component of endoplasmic reticulum membrane (GO:0030176) |
GO function: | enzyme regulator activity (GO:0030234) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry DPM2