The domain within your query sequence starts at position 89 and ends at position 176; the E-value for the DRMBL domain shown below is 7.4e-20.
GLADVFTVEEEAGRIHAVDHTEICHSAMLQWNQSHPTIAIFPTSRKVRSPHPSIYTVPYS DHSSYSELRAFVAALRPCQVVPIVHQKP
DRMBL |
 |
|---|
| PFAM accession number: | PF07522 |
|---|---|
| Interpro abstract (IPR011084): | The metallo-beta-lactamase fold contains five sequence motifs. The first four motifs are found in IPR001279 and are common to all metallo-beta-lactamases. The fifth motif appears to be specific to function. This entry represents the fifth motif from metallo-beta-lactamases involved in DNA repair [ (PUBMED:12177301) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry DRMBL