The domain within your query sequence starts at position 1495 and ends at position 1597; the E-value for the DTHCT domain shown below is 4.6e-31.
KRAPKQKKIVETINSDSDSEFGIPKKTTTPKGKGRGAKKRKASGSENEGDYNPGRKPSKT ASKKPKKTSFDQDSDVDIFPSDFTSEPPALPRTGRARKEVKYF
DTHCT |
 |
|---|
| PFAM accession number: | PF08070 |
|---|---|
| Interpro abstract (IPR012542): | The DTCHT region is the C-terminal part of DNA gyrases B / topoisomerase IV / HATPase proteins [ (PUBMED:15112237) ]. This region is composed of quite low complexity sequence. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry DTHCT