The domain within your query sequence starts at position 278 and ends at position 376; the E-value for the DUF1011 domain shown below is 3e-38.

SSRSACLLGLLAITNALTNGVLPAVQSFSCLPYGRLAYHLAVVLGSCANPLACFLAMAVL
CRSLAGLCGLSLLGMLLGSYLMTLAALSPCPPLVGTSAG

DUF1011

DUF1011
PFAM accession number:PF06237
Interpro abstract (IPR009357):

This entry includes a group of animal riboflavin transporters, including SLC52A1, SLC52A2 and SLC52A3 from humans. They are plasma membrane proteins that transport vitamin B2 (riboflavin, RF) into cells [ (PUBMED:25284511) ]. In case of infection by retroviruses, they act as cell receptors to retroviral envelopes similar to the porcine endogenous retrovirus (PERV-A) [ (PUBMED:19307586) ].

GO process:riboflavin transport (GO:0032218)
GO component:integral component of plasma membrane (GO:0005887)
GO function:riboflavin transmembrane transporter activity (GO:0032217)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF1011