The domain within your query sequence starts at position 278 and ends at position 376; the E-value for the DUF1011 domain shown below is 3e-38.
SSRSACLLGLLAITNALTNGVLPAVQSFSCLPYGRLAYHLAVVLGSCANPLACFLAMAVL CRSLAGLCGLSLLGMLLGSYLMTLAALSPCPPLVGTSAG
DUF1011 |
![]() |
---|
PFAM accession number: | PF06237 |
---|---|
Interpro abstract (IPR009357): | This entry includes a group of animal riboflavin transporters, including SLC52A1, SLC52A2 and SLC52A3 from humans. They are plasma membrane proteins that transport vitamin B2 (riboflavin, RF) into cells [ (PUBMED:25284511) ]. In case of infection by retroviruses, they act as cell receptors to retroviral envelopes similar to the porcine endogenous retrovirus (PERV-A) [ (PUBMED:19307586) ]. |
GO process: | riboflavin transport (GO:0032218) |
GO component: | integral component of plasma membrane (GO:0005887) |
GO function: | riboflavin transmembrane transporter activity (GO:0032217) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF1011