The domain within your query sequence starts at position 15 and ends at position 154; the E-value for the DUF1075 domain shown below is 3.8e-56.
FTTHRAPQIISRWPRWGPRVACHPCSSSGQNPSGFEPPEKVHRIPAQYKPSKFDKKILLW TGRFKSIEDIPPLVPPEMIAVSRNKARVKACYIMIGLTIVACFAVIVSAKRAVERHESLT SWNLAKKAKWREEAALAAQS
DUF1075 |
![]() |
---|
PFAM accession number: | PF06388 |
---|---|
Interpro abstract (IPR009432): | This family consists of several eukaryotic proteins of unknown function. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF1075