The domain within your query sequence starts at position 1956 and ends at position 2122; the E-value for the DUF1088 domain shown below is 3.5e-91.
EGRLLCHAMKDHIVRVANEAEFILNRQRAEDVHKHAEFESQCAQYAADRREEEKMCDHLI SAAKHRDHVTANQLKQKILNILTNKHGAWGAVSHSQLHDFWRLDYWEDDLRRRRRFVRNA FGSTHAEALLKSAVEYGTEEDVVKSKKAFRSQAIVNQNSETELMLEG
DUF1088 |
![]() |
---|
PFAM accession number: | PF06469 |
---|---|
Interpro abstract (IPR010508): | This domain is found in the neurobeachins. The function of this region is not known. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF1088