The domain within your query sequence starts at position 13 and ends at position 72; the E-value for the DUF1143 domain shown below is 3.3e-39.

LQFGHAFETTYDANYSRKKPQSTHRFKREPHWFPGHQPELDPPHYKCTAKSTYMTNYSEP

DUF1143

DUF1143
PFAM accession number:PF06608
Interpro abstract (IPR009524):

This family consists of several hypothetical mammalian proteins (from mouse and human). The function of this family is unknown.

GO component:nucleus (GO:0005634)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF1143