The domain within your query sequence starts at position 42 and ends at position 180; the E-value for the DUF1168 domain shown below is 1.9e-51.
PDKAVPIPEKMNEWAPRAPPEFVRDVMGSSAGAGSGEFHVYRHLRRREYQRQDYMDAMAE KQKLDAEFQKRLEKNKIAAEEQTAKRRKKRQKLKEKKLLAKKMKLEQKKQKEEPSQCQEQ HASSSDEASETEEEEEEPS
DUF1168 |
---|
PFAM accession number: | PF06658 |
---|---|
Interpro abstract (IPR009548): | Prkrip1, also known as protein C114, is a double-stranded RNA-binding protein [ (PUBMED:12679338) ]. It consists of a fully extended N-terminal loop (residues 51-75) and an 18-turn alpha helix (residues 76-142). It directly links the catalytic centre with the U2 snRNP at the periphery of the spliceosome [ (PUBMED:28502770) ]. |
GO function: | double-stranded RNA binding (GO:0003725) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF1168