The domain within your query sequence starts at position 89 and ends at position 305; the E-value for the DUF1170 domain shown below is 4.4e-90.
MDASLKKEKPAILDLYIPPPPAVPYSPRDENVSFGYRGHSKSKQPLPVRKGSESPNSFLD QESQRRRFTIADSDQLPGYSVETNVLPTKMRGKTPSYGKPRPLSMPADGNWMGIVDPFAK PRGNGRKGEDALCRYFSNERITPITEESASPMYRFSRPLTERHLVRGADYIRGSRCYINS DLHSSATIPFQEEGSKKKSASSSAKASSGEPSLLVSW
DUF1170 |
---|
PFAM accession number: | PF06663 |
---|---|
Interpro abstract (IPR010599): | This region of unknown function is situated between the IPR001478 and IPR001849 domains in a cytoplasmic and membrane associated protein which appears to function as an adapter protein or regulator of Ras signalling pathways [ (PUBMED:14597674) ]. |
GO process: | regulation of signal transduction (GO:0009966) |
GO component: | membrane (GO:0016020), cytoplasm (GO:0005737) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF1170