SMART: Pfam domain DUF1211

The domain within your query sequence starts at position 256 and ends at position 353; the E-value for the DUF1211 domain shown below is 4.4e-36.

ERVEAFSDGVYAIVATLLILDICEDNVPDPKDVQEKFSGSLVAALGAYGPQFLAYFGSFA
TVGLLWFAHHSLFLHVRKATQTMGLLNILSLAFVGGLP

DUF1211

PFAM accession number:	PF06736
Interpro abstract (IPR010617):	In animals, TMEM175 is an organelle-specific potassium channel specifically responsible for potassium conductance in endosomes and lysosomes. It forms a potassium-permeable leak-like channel, which regulates lumenal pH stability and is required for autophagosome-lysosome fusion. TMEM175 is the major lysosomal K+ conductance [ (PUBMED:26317472) ]. This entry also includes TMEM175 homologues from bacteria and archaea.
GO function:	potassium channel activity (GO:0005267)

PFAM accession number:

PF06736

Interpro abstract (IPR010617):

In animals, TMEM175 is an organelle-specific potassium channel specifically responsible for potassium conductance in endosomes and lysosomes. It forms a potassium-permeable leak-like channel, which regulates lumenal pH stability and is required for autophagosome-lysosome fusion. TMEM175 is the major lysosomal K+ conductance [ (PUBMED:26317472) ].

This entry also includes TMEM175 homologues from bacteria and archaea.

GO function:

potassium channel activity (GO:0005267)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF1211