The domain within your query sequence starts at position 10 and ends at position 44; the E-value for the DUF1242 domain shown below is 3.5e-23.
LLTVILLLICTCAYIRSLAPSILDRNKTGLLGIFW
DUF1242 |
---|
PFAM accession number: | PF06842 |
---|---|
Interpro abstract (IPR009653): | Protein kish is involved in the early part of the secretory pathway [ (PUBMED:19942856) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF1242