The domain within your query sequence starts at position 10 and ends at position 44; the E-value for the DUF1242 domain shown below is 3.5e-23.

LLTVILLLICTCAYIRSLAPSILDRNKTGLLGIFW

DUF1242

 DUF1242
PFAM accession number:PF06842
Interpro abstract (IPR009653):

Protein kish is involved in the early part of the secretory pathway [ (PUBMED:19942856) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF1242