The domain within your query sequence starts at position 249 and ends at position 396; the E-value for the DUF1295 domain shown below is 2.6e-8.
DIIHDGFGFMLVFGDLAWVPFTYSLQAQFLLYHPQPLGLPMALLICLLKVIGYYIFRGAN SQKNTFRKNPSDPSVAGLETIPTATGRQLLVSGWWGMVRHPNYLGDLIMALAWSLPCGLS HGSLPSRAIPSAALLLRPLLHCTAGAPR
DUF1295 |
---|
PFAM accession number: | PF06966 |
---|---|
Interpro abstract (IPR010721): | This family contains a number of bacterial and eukaryotic proteins of unknown function that are approximately 300 residues long. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF1295