The domain within your query sequence starts at position 59 and ends at position 149; the E-value for the DUF1387 domain shown below is 3.6e-25.
WNMTGKKKNNKRKRSKSKQHQGNKDAKDKVERPEVGPLQPQAPLVQNGHMNGCEKDSSSP DSTREKLALTPREKKISILEEPPRAQRGVTG
DUF1387 |
---|
PFAM accession number: | PF07139 |
---|---|
Interpro abstract (IPR009816): | This family represents a conserved region approximately 300 residues long within a number of hypothetical proteins of unknown function that seem to be restricted to mammals. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF1387