The domain within your query sequence starts at position 59 and ends at position 303; the E-value for the DUF1394 domain shown below is 5.4e-12.
YIEQATVHSSMNEMLEEGHDYAVMLYTWRSCSRAIPQVKCNEQPNRVEIYEKTVEVLEPE VTKLMKFMYFQRKAIERFCSEVKRLCHAERRKDFVSEAYLLTLGKFINMFAVLDELKNMK CSVKNDHSAYKRAAQFLRKMADPQSIQESQNLSMFLANHNRITQCLHQQLEVIPGYEELL ADIVNICVDYYENKMYLTPSEKHMLLKVMGFGLYLMDGNVSNIYKLDAKKRINLSKIDKF FKQLQ
DUF1394 |
---|
PFAM accession number: | PF07159 |
---|---|
Interpro abstract (IPR009828): | This domain has been annotated as Rac1-binding domain [ (PUBMED:31413787) (PUBMED:30250061) ]. It can be found in human CYRIA/CYRIB and at the N terminus of CYFIP1/2 [ (PUBMED:31285585) ]. CYFIP proteins are known RAC1 effectors that stimulate actin polymerization [ (PUBMED:31285585) ]. In mice, CYRIB (also known as CYRI or FAM49B) negatively regulates RAC1-driven cytoskeletal remodelling and plays a role in restricting infection mediated by Mycobacterium tuberculosis and Listeria monocytogenes [ (PUBMED:31285585) ]. |
GO function: | Rac GTPase binding (GO:0048365) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF1394