The domain within your query sequence starts at position 145 and ends at position 287; the E-value for the DUF1445 domain shown below is 7.2e-54.
VTFIIDCSFSIEEALEQAGIPRRDLTGPSHAGAYKTTVPCATIAGFCCPLVVTMRPIPKD KLERLLQATHAIRGQQGQPIHIGDPGLLGIEALSKPDYGSYVECRPEDVPVFWPSPLTSL EAVISCKAPLAFASPPGCMVMVP
DUF1445 |
![]() |
---|
PFAM accession number: | PF07286 |
---|---|
Interpro abstract (IPR009906): | This family includes mitochondrial D-glutamate cyclase (EC:4.2.1.48), which converts D-glutamate to 5-oxo-D-proline [ (PUBMED:28266638) ]. The family also includes numerous uncharacterized proteins from bacteria. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF1445