The domain within your query sequence starts at position 1 and ends at position 42; the E-value for the DUF155 domain shown below is 8.4e-15.

INLSSDFLITPDFYWDRANLEELYDKTCQFLSITRRVKVMNE

DUF155

 DUF155
PFAM accession number:PF02582
Interpro abstract (IPR003734):

This entry represents a domain found in RMND1 from mammals, Sif2/Sif3 from fission yeasts and Rmd1/Rmd8/YDR282C (Mrx10) from budding yeasts.

RMND1 and its yeast homologue, Mrx10, are mitochondrial proteins required for mitochondrial translation [ (PUBMED:23022098) (PUBMED:23022099) ].

Rmd1 and Rmd8 are cytoplasmic protein required for sporulation [ (PUBMED:12586695) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF155