The domain within your query sequence starts at position 227 and ends at position 404; the E-value for the DUF155 domain shown below is 3.2e-49.
IFLFREGAAVFWNVKEKTMKHVMQVLERHETQPYEVALVHWENEELNYIKTEGQSKLHRG EIKLNSELDLDDAILEKFAFSNALCLSVKLAIWEATLDKFIESIQSIPEALKAGKKVKLS HKEVMQKMGELFALRHRINLSSDFLITPDFYWDRANLEELYDKTCQFLSITRRVKVMN
DUF155 |
---|
PFAM accession number: | PF02582 |
---|---|
Interpro abstract (IPR003734): | This entry represents a domain found in RMND1 from mammals, Sif2/Sif3 from fission yeasts and Rmd1/Rmd8/YDR282C (Mrx10) from budding yeasts. RMND1 and its yeast homologue, Mrx10, are mitochondrial proteins required for mitochondrial translation [ (PUBMED:23022098) (PUBMED:23022099) ]. Rmd1 and Rmd8 are cytoplasmic protein required for sporulation [ (PUBMED:12586695) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF155