SMART: Pfam domain DUF1640

The domain within your query sequence starts at position 105 and ends at position 220; the E-value for the DUF1640 domain shown below is 1.1e-39.

KAQQKMKIELDQVKQQLTNETSRIRADNKLDINLERSRVTDMFTDQEKQLIEATNEFAKK
DTQTKSIISETSNKIDTEIASLKTLMESSKLETIRYLAASVFTCLAIALGFYRFWK

DUF1640

PFAM accession number:	PF07798
Interpro abstract (IPR024461):	This entry includes coiled-coil domain-containing proteins 90 (CCDC90) and related proteins. CCDC90A was reported to be a regulator of the mitochondrial calcium uniporter (MCU) and hence was renamed MCUR1. However, studies in mammals and in yeast homologue fmp32 have shown that it is a cytochrome c oxidase assembly factor and does not directly regulate MCU [ (PUBMED:25565209) ]. The role of CCDC90B proteins is still not known.

PFAM accession number:

PF07798

Interpro abstract (IPR024461):

This entry includes coiled-coil domain-containing proteins 90 (CCDC90) and related proteins. CCDC90A was reported to be a regulator of the mitochondrial calcium uniporter (MCU) and hence was renamed MCUR1. However, studies in mammals and in yeast homologue fmp32 have shown that it is a cytochrome c oxidase assembly factor and does not directly regulate MCU [ (PUBMED:25565209) ]. The role of CCDC90B proteins is still not known.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF1640