The domain within your query sequence starts at position 1 and ends at position 212; the E-value for the DUF1682 domain shown below is 1.3e-53.
XDMDTYVFAVGTRKALLRLQKEMQDLSEFCSDKPKSGAKYGLPDSLAILSEMGEVTEGMM DTKMVHFLTHYADKIESVHFSDQFSGPKIMQEEGQPLKLPDTKRTLLFTFNVPGSGNTYP KDMESLLPLMNMVIYSIDKAKKFRLNREGKQKADKNRARVEENFLKLTHVQRQEAAQSRR EEKKRAEKERIMNEEDPEKQRRLEVRHSEARL
DUF1682 |
---|
PFAM accession number: | PF07946 |
---|---|
Interpro abstract (IPR012879): | The members of this family are all hypothetical eukaryotic proteins of unknown function. One member ( Q920S6 ) is described as being an adipocyte-specific protein, but no evidence of this was found. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF1682