The domain within your query sequence starts at position 107 and ends at position 201; the E-value for the DUF1726 domain shown below is 6.9e-39.
YNETHKILGNTFGMCVLQDFEALTPNLLARTVETVEGGGLVVILLRTMNSLKQLYTMTMD VHSRYRTEAHQDVVGRFNERFILSLASCKKCLVID
DUF1726 |
![]() |
---|
PFAM accession number: | PF08351 |
---|---|
Interpro abstract (IPR013562): | This entry represents a domain found in the N terminus of the bacterial tRNA(Met) cytidine acetyltransferase TmcA. TmcA catalyses the formation of N(4)-acetylcytidine (ac4C) at the wobble position of tRNA(Met), by using acetyl-CoA as an acetyl donor and either ATP or GTP [ (PUBMED:18668122) ]. This modification is thought to ensure precise recognition of the AUG codon by strengthening C-G base-pair interaction and also prevent misrecognition of the near cognate AUA codon [ (PUBMED:19322199) ]. This domain can also be found in mammalian N-acetyltransferase 10 (NAT10) and fungal protein Kre33. Kre33 and NAT10 are RNA cytosine acetyltransferases with specificity toward both 18S rRNA and tRNAs [ (PUBMED:25653167) (PUBMED:25402480) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF1726