The domain within your query sequence starts at position 290 and ends at position 369; the E-value for the DUF1736 domain shown below is 3e-35.
IMGTGPPAFTEVDNPASFADSMLVRAINYNYYYSLNAWLLLCPWWLCFDWSMGCIPLIKS VGDWRVIALAALWLCLIGLI
DUF1736 |
![]() |
---|
PFAM accession number: | PF08409 |
---|---|
Interpro abstract (IPR013618): | This domain of unknown function is found in various hypothetical metazoan proteins. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF1736