The domain within your query sequence starts at position 351 and ends at position 425; the E-value for the DUF1736 domain shown below is 1.3e-33.
GGTMPLFSEQDNPASFSPYILTRFLTYSYLLAFNVWLLLAPITLCYDWQVGSIPLVETIW DVRNLATILLAVVMA
DUF1736 |
---|
PFAM accession number: | PF08409 |
---|---|
Interpro abstract (IPR013618): | This domain of unknown function is found in various hypothetical metazoan proteins. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF1736