The domain within your query sequence starts at position 131 and ends at position 290; the E-value for the DUF1776 domain shown below is 1.9e-7.
RGTISDTIVDVDRKVMEINYFGPVALTKALLPSMVERKQGHIVAISSIQGKISIPFRSAY SASKHATQAFFDCLRAEMEEANIKVTVISPGYIHTNLSVNAVTADGSRYGALDKNTAQGR SAAEVAQDVFDAVGKKKKDVLLTDFVPSMAVYIRTLAPGL
DUF1776 |
---|
PFAM accession number: | PF08643 |
---|---|
Interpro abstract (IPR013952): | This is a fungal protein of unknown function. One of the proteins P32792 has been localised to the mitochondria [ (PUBMED:14576278) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF1776