The domain within your query sequence starts at position 13 and ends at position 46; the E-value for the DUF1897 domain shown below is 5.4e-5.
AAPQASSPPDYTMAWAEYYRQQAAFYGQTLGQAQ
DUF1897 |
![]() |
---|
PFAM accession number: | PF09005 |
---|---|
Interpro abstract (IPR015096): | This entry represents a domain found in the C terminus of Far upstream element-binding protein 1/2 (FUBP1/2) [ (PUBMED:8940189) ]. FUBP1 regulates MYC expression by binding to a single-stranded far-upstream element (FUSE) upstream of the MYC promoter [ (PUBMED:8125259) (PUBMED:28076379) ]. FUBP2, also known as KSRP (K homology-type splicing regulatory protein), is an single-strand-RNA binding protein that integrate different levels of gene expression and is required for proper immune response, lipid metabolism, cell fate decisions, and tissue regeneration [ (PUBMED:24845017) ]. |
GO process: | regulation of transcription, DNA-templated (GO:0006355) |
GO function: | nucleic acid binding (GO:0003676) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF1897