The domain within your query sequence starts at position 243 and ends at position 349; the E-value for the DUF1977 domain shown below is 1.7e-28.
ITQLLAANPPYSLFYKSTLGYTISRETQNLQVPYFVDKNFDKAYRGASLRDLEKTIEKDY IDYIQTSCWKEKQQKSELTNLAGLYRDERLRQKAESLKLENCAKLSK
DUF1977 |
 |
|---|
| PFAM accession number: | PF09320 |
|---|---|
| Interpro abstract (IPR015399): | This C-terminal domain is functionally uncharacterised and predominantly found in Dnaj-like proteins. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF1977