The domain within your query sequence starts at position 331 and ends at position 401; the E-value for the DUF2012 domain shown below is 5.7e-10.
PDGEGVPEAVVTLNNQIKVKTKADGSFRLENITTGTYTIHAQKEHLYFEMVTIKIAPNTP QLADLIATGFS
DUF2012 |
![]() |
---|
PFAM accession number: | PF09430 |
---|---|
Interpro abstract (IPR019008): | This domain is found in different proteins, including uncharacterised protein family UPF0480 and nodal modulators. A nodal modulator has been identified as part of a protein complex that participates in the nodal signaling pathway during vertebrate development [ (PUBMED:15257293) ]. This domain is also found in ER membrane protein complex subunit 7 (EMC7), which is a component of the endoplasmic reticulum membrane protein complex and may be involved in degradation of misfolded proteins by the ubiquitin- and proteasome-dependent process known as ER-associated degradation (ERAD)[ (PUBMED:22119785) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF2012