The domain within your query sequence starts at position 109 and ends at position 150; the E-value for the DUF2028 domain shown below is 3.1e-22.

EVPQLNFGMADPTQMGGLSMLLLAGEHALGTPEISSRTSHPD

DUF2028

 DUF2028
PFAM accession number:PF09667
Interpro abstract (IPR019102):

This entry represents a conserved domain found the in HMG box transcription factor BBX. This protein is necessary for cell cycle progression from the G1 to the S phase [ (PUBMED:11680820) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF2028