The domain within your query sequence starts at position 504 and ends at position 610; the E-value for the DUF2043 domain shown below is 6e-43.
ARAPIVPFGVDLCYWGQEQLTAGKILKSDSQHRFWKPSEVEEEVDSAHVSEMLHSRHITF SGTFEPVQHKCRALRPNGRLCERQDRLKCPFHGKIIPRDDKGQPLNP
DUF2043 |
---|
PFAM accession number: | PF09740 |
---|---|
Interpro abstract (IPR018610): | UVSSA is part of a UV-induced ubiquitinated protein complex involved in transcription-coupled nucleotide excision repair (TC-NER) in response to UV damage. It stabilise the TC-NER master organizing protein ERCC6 (also known as CSB) by delivering the deubiquitinating enzyme USP7 to TC-NER complexes [ (PUBMED:22466611) ]. |
GO process: | response to UV (GO:0009411) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF2043