The domain within your query sequence starts at position 25 and ends at position 264; the E-value for the DUF2045 domain shown below is 7.4e-123.
KDDRIVFWTWMFSTYFMEKLAPRQDDMLFYVRRKRAYPGNEGTIDGRKAEAEPEVEVEVY RRDSKKLPGLGDPDIDWEESVCLNLILQKLDYMVTCAVCTRADGGDIHIHRKKSQQVFAS PSKHPMDSKGEESKMSYPNIFFMIDSFEEVFSDMTVGEGEMVCVELVASDKTNTFQGVIF QGSIRYEALKKVYDNRVSVAARMAQKMSFGFYKYNNMEFVRMKGPQGKGHAEMAVSRVST
DUF2045 |
![]() |
---|
PFAM accession number: | PF09741 |
---|---|
Interpro abstract (IPR019141): | This entry is the conserved 250 residues of proteins of approximately 450 amino acids. It contains several highly conserved motifs including a CVxLxxxD motif. The function is unknown. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF2045