The domain within your query sequence starts at position 70 and ends at position 195; the E-value for the DUF2054 domain shown below is 2e-48.
RPSNQCRNSVQGKHLLTDELGYVCERKDLLANGCCDVSVPSTKQYCCDGCLANGCCEAYE YCVSCCLQPSKQLLLERFLNRAAVAFQNLFMAVEDHFELCLAKCRTSSQSVQHENTYRDP IAKYCY
DUF2054 |
![]() |
---|
PFAM accession number: | PF10218 |
---|---|
Interpro abstract (IPR019352): | SPRING1 is a glycosylated Golgi-resident membrane protein involved in SREBP signaling and cholesterol metabolism. It modulates the proper localization of SCAP (SREBP cleavage-activating protein) to the endoplasmic reticulum, thereby controlling the level of functional SCAP [ (PUBMED:32111832) ]. |
GO process: | positive regulation of SREBP signaling pathway (GO:2000640) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF2054