The domain within your query sequence starts at position 592 and ends at position 642; the E-value for the DUF2075 domain shown below is 1.9e-7.
TRELFVHGLPGSGKTIIAMKIMEKIRNTFHCETDRILYICENQPLRDFIQ
DUF2075 |
![]() |
---|
PFAM accession number: | PF09848 |
---|---|
Interpro abstract (IPR018647): | This domain, found in putative ATP/GTP binding proteins, has no known function. It is found in some proteins described as Schlafen family members, which may have a role in hematopoeitic cell differentiation [ (PUBMED:15351786) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF2075