The domain within your query sequence starts at position 66 and ends at position 130; the E-value for the DUF2358 domain shown below is 5e-19.
AVMHERLRQELPTLFLRSHDYTIYSMDVEFINEILNIRTKGRTFYVMSLTLCRFLVWNYF AQFRL
DUF2358 |
 |
|---|
| PFAM accession number: | PF10184 |
|---|---|
| Interpro abstract (IPR018790): | This entry represents a family of conserved proteins. The function is unknown. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF2358