The domain within your query sequence starts at position 7 and ends at position 176; the E-value for the DUF2431 domain shown below is 1.4e-44.
LLVGEGNFSFAASLIDGLDPSVSVTATGFQHRAALEGDPVALENLKRLRERGVEVRFGVD CTQLSHALPADDRDFDRIYFNFPHCGRKAGVAKNRELLAKFFQSCADVLAKAGEVHVTLC RGQGGTPADKPQREWHNSWQVVAMAALGGFILSDVCPFSCEAVPGYKCTG
DUF2431 |
---|
PFAM accession number: | PF10354 |
---|---|
Interpro abstract (IPR019446): | This entry represents the N-terminal domain of a family of proteins whose function is not known. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF2431