SMART: Pfam domain DUF2448

The domain within your query sequence starts at position 191 and ends at position 392; the E-value for the DUF2448 domain shown below is 2.1e-103.

FRRREADQAHGQSFSSSAVKAPFQVILLRALAFLACAFLLFTTLYGPSEPFTPGAALPPA
LPPGGNSSAASDNTTSQAEGWQQLLGLLPEHATEKLHEAWAFGQSHQTSIVAVGLLTCLL
AMLLAGRIRLRRIDAFSTCLWALLLGLHLAEHYLQAASPGWLDTLKFSTTSLCCLVGFTA
AVATRKSTGPRRFRPRRSEKQQ

DUF2448

PFAM accession number:	PF10476
Interpro abstract (IPR018861):	TMEM201, also known as SAMP1, is a RanGTP binding transmembrane protein found in the inner nuclear membrane [ (PUBMED:27541860) ]. It is functionally associated with the LINC complex protein Sun1 and proteins of the A-type lamina network [ (PUBMED:21610090) ]. This entry represents the C-terminal domain of TMEM201.
GO component:	integral component of nuclear inner membrane (GO:0005639)

PFAM accession number:

PF10476

Interpro abstract (IPR018861):

TMEM201, also known as SAMP1, is a RanGTP binding transmembrane protein found in the inner nuclear membrane [ (PUBMED:27541860) ]. It is functionally associated with the LINC complex protein Sun1 and proteins of the A-type lamina network [ (PUBMED:21610090) ].

This entry represents the C-terminal domain of TMEM201.

GO component:

integral component of nuclear inner membrane (GO:0005639)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF2448