The domain within your query sequence starts at position 1 and ends at position 87; the E-value for the DUF2462 domain shown below is 5.5e-25.

MAQGQRKFQAQKPKSKAAAAERSRGPRKGGRVIAPKKARVVQQQKLKKSLEVGIRKKIEH
DVVMKASSSLPKRLALLKGASKKSEAT

DUF2462

 DUF2462
PFAM accession number:PF09495
Interpro abstract (IPR019034):

This protein family is highly conserved, but its function is unknown. It can be isolated from HeLa cell nucleoli and is found to be homologous with Leydig cell tumour protein whose function is unknown [ (PUBMED:15635413) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF2462