The domain within your query sequence starts at position 1 and ends at position 114; the E-value for the DUF2465 domain shown below is 1.9e-22.
XATVLREPGGGLRLLRFLCSELQAARLLHLRLQRDSSPVPSFGEGTKKANGVVQELTLTL QALGLPRPLRGTLASQLLREFHDKISELLPSLPPESMKPLLNSQLDASRWAHGE
DUF2465 |
![]() |
---|
PFAM accession number: | PF10239 |
---|---|
Interpro abstract (IPR018797): | FAM98A, B and C are glycine-rich proteins found from worms to humans. FAM98A contains a tubulin-binding calponin homology domain. It interacts with PLEKHM1 and functions in lysosome positioning in osteoclasts [ (PUBMED:27777970) ]. FAM98A and FAM98B are included in a novel complex with DDX1 and C14orf166 and are involved in colorectal cancer progression [ (PUBMED:28040436) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF2465