The domain within your query sequence starts at position 19 and ends at position 84; the E-value for the DUF2475 domain shown below is 2.3e-28.
PPALMPGYKGHVPGVASSFGSSYGNTTFKYFQDLRNTGLEKSYALLSGGCFPTIFSPNSP LVLTDN
DUF2475 |
![]() |
---|
PFAM accession number: | PF10629 |
---|---|
Interpro abstract (IPR018902): | This entry includes FAM166A/B/C, and members of the UPF0605 protein family. Both these families of proteins have no known function. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF2475