The domain within your query sequence starts at position 232 and ends at position 271; the E-value for the DUF2475 domain shown below is 7.7e-10.

NLGLLPHYGGYVPGYKFQFGGTFGHLTHDALGLSITQKQL

DUF2475

DUF2475
PFAM accession number:PF10629
Interpro abstract (IPR018902):

This entry includes FAM166A/B/C, and members of the UPF0605 protein family. Both these families of proteins have no known function.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF2475