The domain within your query sequence starts at position 1 and ends at position 141; the E-value for the DUF2477 domain shown below is 2.2e-92.
MDPHEMVVKNPYAHISIPRAHLRSDLGQQLEEVPSSSSSSETQPLPAGTCIPEPVGLLQT TEAPGPKGIKGIKGTAPEHGQQTWQSPCNPYSSGQRPSGLTYAGLPPVGRGDDIAHHCCC CPCCSCCHCPRFCRCHSCCVI
DUF2477 |
---|
PFAM accession number: | PF10631 |
---|---|
Interpro abstract (IPR018904): | This is a family of proteins with no known function. The family is rich in proline residues. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF2477